PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_AB2BAE660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 155aa    MW: 16930.5 Da    PI: 8.0496
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_AB2BAE660.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY62.57.6e-20119155137
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEE CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkk 37 
                            ldDgy+WrKYG+K+vk+s++pr+YYrC+s+gC+vkk+
  Traes_3AL_AB2BAE660.1 119 LDDGYRWRKYGKKMVKNSPNPRNYYRCSSEGCRVKKR 155
                            59*********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-21106155IPR003657WRKY domain
SuperFamilySSF1182902.62E-18112154IPR003657WRKY domain
PROSITE profilePS5081122.022114155IPR003657WRKY domain
SMARTSM007749.8E-10119155IPR003657WRKY domain
PfamPF031061.9E-14120155IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MSSYSSLLSV SPGEQIGGYA DGGDHDDMAA AANYLSSFCF DFGEEYYSLA EAATASYPLH  60
AQQQQQPPTQ ADSHHSGKAA STTSSSQGLD NINTSLTSSD ARSKGSKIAF KTRSEVEVLD  120
DGYRWRKYGK KMVKNSPNPR NYYRCSSEGC RVKKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-16109154752Probable WRKY transcription factor 4
1wj2_A3e-16109154752Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8274030.0KR827403.1 Triticum aestivum WRKY52 transcriptional factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566817.13e-45PREDICTED: probable WRKY transcription factor 75
TrEMBLW5CFQ41e-113W5CFQ4_WHEAT; Uncharacterized protein
STRINGSi002862m4e-38(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.12e-27WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]